Tiv tauj peb
- Room 309, Meihua Building, Taiwan Industrial Park, No.2132 Songbai Road, Bao'an District, Shenzhen, Suav teb
- sales@biorunstar.com
- +86-0755 2308 4243

PACAP-27 (Pituitary Adenylate Cyclase-Activating Polypeptide-27) yog ib qho neuropeptide muaj li ntawm 27 amino acids, tau txais txiaj ntsig zoo thoob plaws cov tsiaj xws li tib neeg, nas, yaj, npua, thiab nas. Nws yog muab los ntawm tib lub precursor li PACAP-38 thiab nthuav tawm cov haujlwm lom neeg zoo sib xws los ntawm kev cuam tshuam nrog PAC1, VPAC1, thiab VPAC2 receptors.
Specifications
|
Sequence ib tsab ntawv code |
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
|
Sequence peb tsab ntawv code |
Nws-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala- Val-Leu-NH2 |
|
CAS Nr |
127317-03-7 |
|
Molecular Formula |
C142H224N40O39S1 |
|
Molecular Luj |
3147.65 |
|
Kev hloov kho |
C-terminal Amidation |
|
Purity |
Peak Area los ntawm HPLC Ntau dua lossis sib npaug li 95% |
|
Daim ntawv |
Lyophilized |
|
Ntev Cia |
- 20 degree lossis qis dua |
| Rau kev tshawb fawb siv nkaus xwb. | |
Cov ntaub ntawv:
1. Vaudry li al., "PACAP thiab nws cov receptors: Neuroprotective thiab regenerative mechanisms," Pharmacological Reviews, 2009.
2. Abad et al., "Lub luag hauj lwm ntawm PACAP hauv kev tiv thaiv kab mob thiab kev mob," Journal of Neuroimmunology, 2006.
3. Szakaly et al., "Kev tiv thaiv los ntawm PACAP-27 ntawm lub plawv," Phau ntawv Journal of Molecular Neuroscience, 2013.
4. Sundler li al., "PACAP nyob rau hauv lub plab zom mov: Lub luag hauj lwm thiab mechanisms," Annals ntawm New York Academy of Sciences, 1996.
5. Cline et al., "PACAP as a modulator of qog growth," Endocrine-Related Cancer, 2010.
Hot Tags: pacap-27 (tib neeg, nas, ovine, porcine, nas), pacap-27 (tib neeg, nas, ovine, porcine, nas)
You Might Also Like






